Lineage for d2h19a_ (2h19 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877730Protein Thiol-disulfide oxidoreductase ResA [102455] (1 species)
  7. 2877731Species Bacillus subtilis [TaxId:1423] [102456] (8 PDB entries)
  8. 2877742Domain d2h19a_: 2h19 A: [164904]
    automated match to d1st9a_
    complexed with edo

Details for d2h19a_

PDB Entry: 2h19 (more details), 2 Å

PDB Description: crystal structure of resa cys77ala variant
PDB Compounds: (A:) Thiol-disulfide oxidoreductase resA

SCOPe Domain Sequences for d2h19a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h19a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]}
sdapnfvledtngkrielsdlkgkgvflnfwgtwcepakkefpymanqykhfksqgveiv
avnvgeskiavhnfmksygvnfpvvldtdrqvldaydvsplpttflinpegkvvkvvtgt
mtesmihdymnlikpget

SCOPe Domain Coordinates for d2h19a_:

Click to download the PDB-style file with coordinates for d2h19a_.
(The format of our PDB-style files is described here.)

Timeline for d2h19a_: