Lineage for d2h13a_ (2h13 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399257Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2399432Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2399433Protein automated matches [190568] (6 species)
    not a true protein
  7. 2399473Species Human (Homo sapiens) [TaxId:9606] [187559] (46 PDB entries)
  8. 2399479Domain d2h13a_: 2h13 A: [164902]
    automated match to d1vyhc1

Details for d2h13a_

PDB Entry: 2h13 (more details), 1.58 Å

PDB Description: crystal structure of wdr5/histone h3 complex
PDB Compounds: (A:) wd-repeat protein 5

SCOPe Domain Sequences for d2h13a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h13a_ b.69.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgis
dvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfde
svriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktlid
ddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtgg
kwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklwk
sdc

SCOPe Domain Coordinates for d2h13a_:

Click to download the PDB-style file with coordinates for d2h13a_.
(The format of our PDB-style files is described here.)

Timeline for d2h13a_: