Lineage for d2h12e_ (2h12 E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722943Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2722944Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2722945Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2723011Protein automated matches [190675] (10 species)
    not a true protein
  7. 2723012Species Acetobacter aceti [TaxId:435] [187782] (1 PDB entry)
  8. 2723017Domain d2h12e_: 2h12 E: [164900]
    automated match to d1k3pa_
    complexed with cmx, oaa, so4

Details for d2h12e_

PDB Entry: 2h12 (more details), 1.85 Å

PDB Description: structure of acetobacter aceti citrate synthase complexed with oxaloacetate and carboxymethyldethia coenzyme a (cmx)
PDB Compounds: (E:) citrate synthase

SCOPe Domain Sequences for d2h12e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h12e_ a.103.1.1 (E:) automated matches {Acetobacter aceti [TaxId: 435]}
statisvdgksaempvlsgtlgpdvidirklpaqlgvftfdpgygetaacnskitfidgd
kgvllhrgypiaqlaenasyeeviylllngelpnkaqydtftntltnhtllheqirnffn
gfrrdahpmailcgtvgalsafypdandiaipanrdlaamrliakiptiaawaykytqge
afiyprndlnyaenflsmmfarmsepykvnpvlaramnrililhadheqnaststvrlag
stganpfaciaagiaalwgpahgganeavlkmlarigkkenipafiaqvkdknsgvklmg
fghrvyknfdprakimqqtchevltelgikddplldlavelekialsddyfvqrklypnv
dfysgiilkamgiptsmftvlfavarttgwvsqwkemieepgqrisrprqlyigapqrdy
vplakr

SCOPe Domain Coordinates for d2h12e_:

Click to download the PDB-style file with coordinates for d2h12e_.
(The format of our PDB-style files is described here.)

Timeline for d2h12e_: