![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.103.1: Citrate synthase [48256] (2 families) ![]() |
![]() | Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
![]() | Protein automated matches [190675] (10 species) not a true protein |
![]() | Species Acetobacter aceti [TaxId:435] [187782] (1 PDB entry) |
![]() | Domain d2h12b_: 2h12 B: [164897] automated match to d1k3pa_ complexed with cmx, oaa, so4 |
PDB Entry: 2h12 (more details), 1.85 Å
SCOPe Domain Sequences for d2h12b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h12b_ a.103.1.1 (B:) automated matches {Acetobacter aceti [TaxId: 435]} statisvdgksaempvlsgtlgpdvidirklpaqlgvftfdpgygetaacnskitfidgd kgvllhrgypiaqlaenasyeeviylllngelpnkaqydtftntltnhtllheqirnffn gfrrdahpmailcgtvgalsafypdandiaipanrdlaamrliakiptiaawaykytqge afiyprndlnyaenflsmmfarmsepykvnpvlaramnrililhadheqnaststvrlag stganpfaciaagiaalwgpahgganeavlkmlarigkkenipafiaqvkdknsgvklmg fghrvyknfdprakimqqtchevltelgikddplldlavelekialsddyfvqrklypnv dfysgiilkamgiptsmftvlfavarttgwvsqwkemieepgqrisrprqlyigapqrdy vplakr
Timeline for d2h12b_: