SCOPe 2.03: Domain d2h0vb_: 2h0v B:

Lineage for d2h0vb_ (2h0v B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.5: Quercetin 2,3-dioxygenase-like [75035] (3 proteins)
   Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin

6. Protein automated matches [190673] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187779] (1 PDB entry)

8. Domain d2h0vb_: 2h0v B: [164893]
   automated match to d1y3ta1
   complexed with edo, fe, tla, trs

Details for d2h0vb_

PDB Entry: 2h0v, 2.6 Å

PDB Description: crystal structure of a putative quercetin 2,3-dioxygenase (yxag, bsu39980) from bacillus subtilis at 2.60 a resolution

PDB Compounds: (B:) quercetin 2,3-dioxygenase

SCOPe Domain Sequences for d2h0vb_:

Sequence; same for both SEQRES and ATOM records:

>d2h0vb_ b.82.1.5 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tlcthslpkekmpyllrsgegerylfgrqvatvmangrstgdlfeivllsggkgdafplh
vhkdthegilvldgkleltldgeryllisgdyanipagtphsyrmqshrtrlvsytmkgn
vahlysvignpydhaehppyaseevsnerfaeaaavadivfldeakpacsaklaeltelp
dgavpyvlesgegdrlltgdqlhrivaaqkntdgqfivvssegpkgdrivdhyheyhtet
fyclegqmtmwtdgqeiqlnpgdflhvpantvhsyrldshytkmvgvlvpglfepffrtl
gdpyeghifpcepqalrfdrilqniealdlkvmkp

Timeline for d2h0vb_:

• d2h0vb_ first appeared in SCOPe 2.01
  
• d2h0vb_ appears in SCOPe 2.02
  
• d2h0vb_ appears in SCOPe 2.04
  
• d2h0vb_ appears in the current release, SCOPe 2.08