Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.5: Quercetin 2,3-dioxygenase-like [75035] (3 proteins) Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin |
Protein automated matches [190673] (1 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [187779] (1 PDB entry) |
Domain d2h0vb_: 2h0v B: [164893] automated match to d1y3ta1 complexed with edo, fe, tla, trs |
PDB Entry: 2h0v (more details), 2.6 Å
SCOPe Domain Sequences for d2h0vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h0vb_ b.82.1.5 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} tlcthslpkekmpyllrsgegerylfgrqvatvmangrstgdlfeivllsggkgdafplh vhkdthegilvldgkleltldgeryllisgdyanipagtphsyrmqshrtrlvsytmkgn vahlysvignpydhaehppyaseevsnerfaeaaavadivfldeakpacsaklaeltelp dgavpyvlesgegdrlltgdqlhrivaaqkntdgqfivvssegpkgdrivdhyheyhtet fyclegqmtmwtdgqeiqlnpgdflhvpantvhsyrldshytkmvgvlvpglfepffrtl gdpyeghifpcepqalrfdrilqniealdlkvmkp
Timeline for d2h0vb_: