Lineage for d2h0vb_ (2h0v B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 962885Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 963099Family b.82.1.5: Quercetin 2,3-dioxygenase-like [75035] (3 proteins)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin
  6. 963126Protein automated matches [190673] (1 species)
    not a true protein
  7. 963127Species Bacillus subtilis [TaxId:1423] [187779] (1 PDB entry)
  8. 963129Domain d2h0vb_: 2h0v B: [164893]
    automated match to d1y3ta1
    complexed with edo, fe, tla, trs

Details for d2h0vb_

PDB Entry: 2h0v (more details), 2.6 Å

PDB Description: crystal structure of a putative quercetin 2,3-dioxygenase (yxag, bsu39980) from bacillus subtilis at 2.60 a resolution
PDB Compounds: (B:) quercetin 2,3-dioxygenase

SCOPe Domain Sequences for d2h0vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h0vb_ b.82.1.5 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tlcthslpkekmpyllrsgegerylfgrqvatvmangrstgdlfeivllsggkgdafplh
vhkdthegilvldgkleltldgeryllisgdyanipagtphsyrmqshrtrlvsytmkgn
vahlysvignpydhaehppyaseevsnerfaeaaavadivfldeakpacsaklaeltelp
dgavpyvlesgegdrlltgdqlhrivaaqkntdgqfivvssegpkgdrivdhyheyhtet
fyclegqmtmwtdgqeiqlnpgdflhvpantvhsyrldshytkmvgvlvpglfepffrtl
gdpyeghifpcepqalrfdrilqniealdlkvmkp

SCOPe Domain Coordinates for d2h0vb_:

Click to download the PDB-style file with coordinates for d2h0vb_.
(The format of our PDB-style files is described here.)

Timeline for d2h0vb_: