Lineage for d2h0ma_ (2h0m A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717115Protein Annexin V [47883] (3 species)
  7. 2717136Species Norway rat (Rattus norvegicus) [TaxId:10116] [47886] (18 PDB entries)
  8. 2717146Domain d2h0ma_: 2h0m A: [164889]
    automated match to d1a8aa_
    mutant

Details for d2h0ma_

PDB Entry: 2h0m (more details), 2.26 Å

PDB Description: structure of a mutant of rat annexin a5
PDB Compounds: (A:) Annexin A5

SCOPe Domain Sequences for d2h0ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h0ma_ a.65.1.1 (A:) Annexin V {Norway rat (Rattus norvegicus) [TaxId: 10116]}
malrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfg
rdlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeel
raikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdcaiddaqveldaqalfqa
gelkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvk
sirsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikg
dtsgdykkallllsgged

SCOPe Domain Coordinates for d2h0ma_:

Click to download the PDB-style file with coordinates for d2h0ma_.
(The format of our PDB-style files is described here.)

Timeline for d2h0ma_: