Lineage for d2h0kb_ (2h0k B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000010Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2000011Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2000012Family a.65.1.1: Annexin [47875] (10 protein domains)
  6. 2000040Protein Annexin V [47883] (3 species)
  7. 2000061Species Norway rat (Rattus norvegicus) [TaxId:10116] [47886] (18 PDB entries)
  8. 2000079Domain d2h0kb_: 2h0k B: [164887]
    automated match to d1a8aa_
    complexed with ca; mutant

Details for d2h0kb_

PDB Entry: 2h0k (more details), 2.76 Å

PDB Description: Crystal Structure of a Mutant of Rat Annexin A5
PDB Compounds: (B:) Annexin A5

SCOPe Domain Sequences for d2h0kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h0kb_ a.65.1.1 (B:) Annexin V {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alrgtvtdfsgfdgeadaevlekameglgtdedsilnlltarsnaqrqqiaeefetlfgr
dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeeefitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllsggedd

SCOPe Domain Coordinates for d2h0kb_:

Click to download the PDB-style file with coordinates for d2h0kb_.
(The format of our PDB-style files is described here.)

Timeline for d2h0kb_: