Lineage for d2gzba_ (2gzb A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1791370Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 1791480Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 1791481Protein automated matches [190445] (5 species)
    not a true protein
  7. 1791482Species Bauhinia bauhinioides [TaxId:166014] [187352] (3 PDB entries)
  8. 1791485Domain d2gzba_: 2gzb A: [164881]
    automated match to d1tiea_
    complexed with iod

Details for d2gzba_

PDB Entry: 2gzb (more details), 1.7 Å

PDB Description: Bauhinia bauhinioides cruzipain inhibitor (BbCI)
PDB Compounds: (A:) Kunitz-type proteinase inhibitor BbCI

SCOPe Domain Sequences for d2gzba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gzba_ b.42.4.0 (A:) automated matches {Bauhinia bauhinioides [TaxId: 166014]}
hmsvildtkgepvsnaadayylvpvshgegglalakvgneaepkavvldphhrpgltvrf
etplaiaiitesfflnikfvpsssdsevwdvskqypiglavkvtdtksfvgpfrvekege
gykivyypdrgqtgldiglvhrndkyylaategepfvfkirkat

SCOPe Domain Coordinates for d2gzba_:

Click to download the PDB-style file with coordinates for d2gzba_.
(The format of our PDB-style files is described here.)

Timeline for d2gzba_: