Lineage for d1fpob2 (1fpo B:77-171)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699273Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2699274Superfamily a.23.1: HSC20 (HSCB), C-terminal oligomerisation domain [47144] (1 family) (S)
    automatically mapped to Pfam PF07743
  5. 2699275Family a.23.1.1: HSC20 (HSCB), C-terminal oligomerisation domain [47145] (1 protein)
  6. 2699276Protein HSC20 (HSCB), C-terminal oligomerisation domain [47146] (1 species)
  7. 2699277Species Escherichia coli [TaxId:562] [47147] (1 PDB entry)
  8. 2699279Domain d1fpob2: 1fpo B:77-171 [16488]
    Other proteins in same PDB: d1fpoa1, d1fpob1, d1fpoc1

Details for d1fpob2

PDB Entry: 1fpo (more details), 1.8 Å

PDB Description: hsc20 (hscb), a j-type co-chaperone from e. coli
PDB Compounds: (B:) chaperone protein hscb

SCOPe Domain Sequences for d1fpob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpob2 a.23.1.1 (B:77-171) HSC20 (HSCB), C-terminal oligomerisation domain {Escherichia coli [TaxId: 562]}
fdlaseqhtvrdtaflmeqlelreeldeieqakdearlesfikrvkkmfdtrhqlmveql
dnetwdaaadtcrklrfldklrssaeqleeklldf

SCOPe Domain Coordinates for d1fpob2:

Click to download the PDB-style file with coordinates for d1fpob2.
(The format of our PDB-style files is described here.)

Timeline for d1fpob2: