Class g: Small proteins [56992] (94 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.0: automated matches [191392] (1 protein) not a true family |
Protein automated matches [190506] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187459] (23 PDB entries) |
Domain d2gyza_: 2gyz A: [164877] automated match to d1agqa_ |
PDB Entry: 2gyz (more details), 1.76 Å
SCOPe Domain Sequences for d2gyza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gyza_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr pvsqpccrptryeavsfmdvnstwrtvdrlsatacgc
Timeline for d2gyza_: