Lineage for d2gyrf_ (2gyr F:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2584898Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2584899Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2585214Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 2585215Protein automated matches [190506] (3 species)
    not a true protein
  7. 2585216Species Human (Homo sapiens) [TaxId:9606] [187459] (37 PDB entries)
  8. 2585254Domain d2gyrf_: 2gyr F: [164876]
    automated match to d1agqa_

Details for d2gyrf_

PDB Entry: 2gyr (more details), 2.6 Å

PDB Description: Crystal structure of human artemin
PDB Compounds: (F:) Neurotrophic factor artemin, isoform 3

SCOPe Domain Sequences for d2gyrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gyrf_ g.17.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
pvsqpccrptryeavsfmdvnstwrtvdrlsatacgc

SCOPe Domain Coordinates for d2gyrf_:

Click to download the PDB-style file with coordinates for d2gyrf_.
(The format of our PDB-style files is described here.)

Timeline for d2gyrf_: