Lineage for d2gyrc_ (2gyr C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033932Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 3033933Protein automated matches [190506] (3 species)
    not a true protein
  7. 3033934Species Human (Homo sapiens) [TaxId:9606] [187459] (39 PDB entries)
  8. 3033985Domain d2gyrc_: 2gyr C: [164873]
    automated match to d1agqa_

Details for d2gyrc_

PDB Entry: 2gyr (more details), 2.6 Å

PDB Description: Crystal structure of human artemin
PDB Compounds: (C:) Neurotrophic factor artemin, isoform 3

SCOPe Domain Sequences for d2gyrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gyrc_ g.17.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
pvsqpccrptryeavsfmdvnstwrtvdrlsatacgc

SCOPe Domain Coordinates for d2gyrc_:

Click to download the PDB-style file with coordinates for d2gyrc_.
(The format of our PDB-style files is described here.)

Timeline for d2gyrc_: