SCOPe 2.04: Domain d2gx6a_: 2gx6 A:

Lineage for d2gx6a_ (2gx6 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)

6. Protein automated matches [190296] (6 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [187775] (6 PDB entries)

8. Domain d2gx6a_: 2gx6 A: [164870]
   automated match to d1urpa_
   complexed with rip

Details for d2gx6a_

PDB Entry: 2gx6, 1.97 Å

PDB Description: rational stabilization of e. coli ribose binding protein

PDB Compounds: (A:) D-ribose-binding periplasmic protein

SCOPe Domain Sequences for d2gx6a_:

Sequence; same for both SEQRES and ATOM records:

>d2gx6a_ c.93.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgvki
llinpvdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
gakgvevadkvlkgekvqakypvdlklvvkq

Timeline for d2gx6a_:

• d2gx6a_ first appeared in SCOPe 2.01
  
• d2gx6a_ appears in SCOPe 2.03
  
• d2gx6a_ appears in SCOPe 2.05
  
• d2gx6a_ appears in the current release, SCOPe 2.08