Lineage for d2gx6a_ (2gx6 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390243Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1390244Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1390245Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1390446Protein automated matches [190296] (6 species)
    not a true protein
  7. 1390449Species Escherichia coli K-12 [TaxId:83333] [187775] (5 PDB entries)
  8. 1390452Domain d2gx6a_: 2gx6 A: [164870]
    automated match to d1urpa_
    complexed with rip

Details for d2gx6a_

PDB Entry: 2gx6 (more details), 1.97 Å

PDB Description: rational stabilization of e. coli ribose binding protein
PDB Compounds: (A:) D-ribose-binding periplasmic protein

SCOPe Domain Sequences for d2gx6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gx6a_ c.93.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgvki
llinpvdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
gakgvevadkvlkgekvqakypvdlklvvkq

SCOPe Domain Coordinates for d2gx6a_:

Click to download the PDB-style file with coordinates for d2gx6a_.
(The format of our PDB-style files is described here.)

Timeline for d2gx6a_: