Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
Protein automated matches [190296] (11 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [187775] (6 PDB entries) |
Domain d2gx6a_: 2gx6 A: [164870] automated match to d1urpa_ complexed with rip |
PDB Entry: 2gx6 (more details), 1.97 Å
SCOPe Domain Sequences for d2gx6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gx6a_ c.93.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgvki llinpvdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi gakgvevadkvlkgekvqakypvdlklvvkq
Timeline for d2gx6a_: