| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.1: HSC20 (HSCB), C-terminal oligomerisation domain [47144] (1 family) ![]() automatically mapped to Pfam PF07743 |
| Family a.23.1.1: HSC20 (HSCB), C-terminal oligomerisation domain [47145] (1 protein) |
| Protein HSC20 (HSCB), C-terminal oligomerisation domain [47146] (1 species) |
| Species Escherichia coli [TaxId:562] [47147] (1 PDB entry) |
| Domain d1fpoa2: 1fpo A:77-171 [16487] Other proteins in same PDB: d1fpoa1, d1fpob1, d1fpoc1 |
PDB Entry: 1fpo (more details), 1.8 Å
SCOPe Domain Sequences for d1fpoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fpoa2 a.23.1.1 (A:77-171) HSC20 (HSCB), C-terminal oligomerisation domain {Escherichia coli [TaxId: 562]}
fdlaseqhtvrdtaflmeqlelreeldeieqakdearlesfikrvkkmfdtrhqlmveql
dnetwdaaadtcrklrfldklrssaeqleeklldf
Timeline for d1fpoa2:
View in 3DDomains from other chains: (mouse over for more information) d1fpob1, d1fpob2, d1fpoc1, d1fpoc2 |