Lineage for d2gw8a1 (2gw8 A:1-112)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950564Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2950640Protein automated matches [190670] (7 species)
    not a true protein
  7. 2950677Species Neisseria meningitidis [TaxId:122586] [187774] (1 PDB entry)
  8. 2950678Domain d2gw8a1: 2gw8 A:1-112 [164866]
    Other proteins in same PDB: d2gw8a2
    automated match to d1pila_

Details for d2gw8a1

PDB Entry: 2gw8 (more details), 1.85 Å

PDB Description: Structure of the PII signal transduction protein of Neisseria meningitidis at 1.85 resolution
PDB Compounds: (A:) PII signal transduction protein

SCOPe Domain Sequences for d2gw8a1:

Sequence, based on SEQRES records: (download)

>d2gw8a1 d.58.5.1 (A:1-112) automated matches {Neisseria meningitidis [TaxId: 122586]}
mkkieaivkpfklddvrealteigitgmtvsevkgfgrqkghteiyrgaeyavdflpkik
ielvladdaveraidvivevarsgkigdgkifvlpveeairirtgersdaav

Sequence, based on observed residues (ATOM records): (download)

>d2gw8a1 d.58.5.1 (A:1-112) automated matches {Neisseria meningitidis [TaxId: 122586]}
mkkieaivkpfklddvrealteigitgmtvsevkgfgrvdflpkikielvladdaverai
dvivevarsgkigdgkifvlpveeairirtgersdaav

SCOPe Domain Coordinates for d2gw8a1:

Click to download the PDB-style file with coordinates for d2gw8a1.
(The format of our PDB-style files is described here.)

Timeline for d2gw8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gw8a2