![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
![]() | Protein automated matches [190670] (7 species) not a true protein |
![]() | Species Neisseria meningitidis [TaxId:122586] [187774] (1 PDB entry) |
![]() | Domain d2gw8a1: 2gw8 A:1-112 [164866] Other proteins in same PDB: d2gw8a2 automated match to d1pila_ |
PDB Entry: 2gw8 (more details), 1.85 Å
SCOPe Domain Sequences for d2gw8a1:
Sequence, based on SEQRES records: (download)
>d2gw8a1 d.58.5.1 (A:1-112) automated matches {Neisseria meningitidis [TaxId: 122586]} mkkieaivkpfklddvrealteigitgmtvsevkgfgrqkghteiyrgaeyavdflpkik ielvladdaveraidvivevarsgkigdgkifvlpveeairirtgersdaav
>d2gw8a1 d.58.5.1 (A:1-112) automated matches {Neisseria meningitidis [TaxId: 122586]} mkkieaivkpfklddvrealteigitgmtvsevkgfgrvdflpkikielvladdaverai dvivevarsgkigdgkifvlpveeairirtgersdaav
Timeline for d2gw8a1: