Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (11 species) not a true protein |
Species Trachyphyllia geoffroyi [TaxId:196280] [188530] (1 PDB entry) |
Domain d2gw3b_: 2gw3 B: [164865] automated match to d1mova_ complexed with ni |
PDB Entry: 2gw3 (more details), 1.4 Å
SCOPe Domain Sequences for d2gw3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gw3b_ d.22.1.0 (B:) automated matches {Trachyphyllia geoffroyi [TaxId: 196280]} pmslikpemkikllmegnvnghqfviegdgkghpfegkqsmdlvvkegaplpfaydiltt afhygnrvfakypdhipdyfkqsfpkgfswerslmfedggvciatnditlkgdtffnkvr fdgvnfppngpvmqkktlkweastekmylrdgvltgditmalllkgdvhyrcdfrttyks rqegvklpgyhfvdhcisilrhdkdynevklyehavahsgl
Timeline for d2gw3b_: