Lineage for d2gw3b_ (2gw3 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021948Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1021949Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1022370Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1022371Protein automated matches [190526] (7 species)
    not a true protein
  7. 1022468Species Trachyphyllia geoffroyi [TaxId:196280] [188530] (1 PDB entry)
  8. 1022470Domain d2gw3b_: 2gw3 B: [164865]
    automated match to d1mova_
    complexed with ni

Details for d2gw3b_

PDB Entry: 2gw3 (more details), 1.4 Å

PDB Description: Crystal structure of stony coral fluorescent protein Kaede, green form
PDB Compounds: (B:) Kaede

SCOPe Domain Sequences for d2gw3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gw3b_ d.22.1.0 (B:) automated matches {Trachyphyllia geoffroyi [TaxId: 196280]}
pmslikpemkikllmegnvnghqfviegdgkghpfegkqsmdlvvkegaplpfaydiltt
afhygnrvfakypdhipdyfkqsfpkgfswerslmfedggvciatnditlkgdtffnkvr
fdgvnfppngpvmqkktlkweastekmylrdgvltgditmalllkgdvhyrcdfrttyks
rqegvklpgyhfvdhcisilrhdkdynevklyehavahsgl

SCOPe Domain Coordinates for d2gw3b_:

Click to download the PDB-style file with coordinates for d2gw3b_.
(The format of our PDB-style files is described here.)

Timeline for d2gw3b_: