SCOPe 2.01: Domain d2gw3b_: 2gw3 B:

Lineage for d2gw3b_ (2gw3 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (7 species)
   not a true protein

7. Species Trachyphyllia geoffroyi [TaxId:196280] [188530] (1 PDB entry)

8. Domain d2gw3b_: 2gw3 B: [164865]
   automated match to d1mova_
   complexed with ni

Details for d2gw3b_

PDB Entry: 2gw3, 1.4 Å

PDB Description: Crystal structure of stony coral fluorescent protein Kaede, green form

PDB Compounds: (B:) Kaede

SCOPe Domain Sequences for d2gw3b_:

Sequence; same for both SEQRES and ATOM records:

>d2gw3b_ d.22.1.0 (B:) automated matches {Trachyphyllia geoffroyi [TaxId: 196280]}
pmslikpemkikllmegnvnghqfviegdgkghpfegkqsmdlvvkegaplpfaydiltt
afhygnrvfakypdhipdyfkqsfpkgfswerslmfedggvciatnditlkgdtffnkvr
fdgvnfppngpvmqkktlkweastekmylrdgvltgditmalllkgdvhyrcdfrttyks
rqegvklpgyhfvdhcisilrhdkdynevklyehavahsgl

Timeline for d2gw3b_:

• d2gw3b_ is new in SCOPe 2.01-stable
  
• d2gw3b_ appears in SCOPe 2.02
  
• d2gw3b_ appears in the current release, SCOPe 2.08, called d2gw3b1