SCOPe 2.08: Domain d2gw3b1: 2gw3 B:1-220

Lineage for d2gw3b1 (2gw3 B:1-220)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Trachyphyllia geoffroyi [TaxId:196280] [188530] (1 PDB entry)

8. Domain d2gw3b1: 2gw3 B:1-220 [164865]
   Other proteins in same PDB: d2gw3a2, d2gw3b2
   automated match to d1mova_
   complexed with ni

Details for d2gw3b1

PDB Entry: 2gw3, 1.4 Å

PDB Description: Crystal structure of stony coral fluorescent protein Kaede, green form

PDB Compounds: (B:) Kaede

SCOPe Domain Sequences for d2gw3b1:

Sequence; same for both SEQRES and ATOM records:

>d2gw3b1 d.22.1.0 (B:1-220) automated matches {Trachyphyllia geoffroyi [TaxId: 196280]}
mslikpemkikllmegnvnghqfviegdgkghpfegkqsmdlvvkegaplpfaydiltta
fhygnrvfakypdhipdyfkqsfpkgfswerslmfedggvciatnditlkgdtffnkvrf
dgvnfppngpvmqkktlkweastekmylrdgvltgditmalllkgdvhyrcdfrttyksr
qegvklpgyhfvdhcisilrhdkdynevklyehavahsgl

Timeline for d2gw3b1:

• d2gw3b1 first appeared in SCOPe 2.01, called d2gw3b_
  
• d2gw3b1 appears in SCOPe 2.07