Lineage for d2gw3b1 (2gw3 B:1-220)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2941139Species Trachyphyllia geoffroyi [TaxId:196280] [188530] (1 PDB entry)
  8. 2941141Domain d2gw3b1: 2gw3 B:1-220 [164865]
    Other proteins in same PDB: d2gw3a2, d2gw3b2
    automated match to d1mova_
    complexed with ni

Details for d2gw3b1

PDB Entry: 2gw3 (more details), 1.4 Å

PDB Description: Crystal structure of stony coral fluorescent protein Kaede, green form
PDB Compounds: (B:) Kaede

SCOPe Domain Sequences for d2gw3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gw3b1 d.22.1.0 (B:1-220) automated matches {Trachyphyllia geoffroyi [TaxId: 196280]}
mslikpemkikllmegnvnghqfviegdgkghpfegkqsmdlvvkegaplpfaydiltta
fhygnrvfakypdhipdyfkqsfpkgfswerslmfedggvciatnditlkgdtffnkvrf
dgvnfppngpvmqkktlkweastekmylrdgvltgditmalllkgdvhyrcdfrttyksr
qegvklpgyhfvdhcisilrhdkdynevklyehavahsgl

SCOPe Domain Coordinates for d2gw3b1:

Click to download the PDB-style file with coordinates for d2gw3b1.
(The format of our PDB-style files is described here.)

Timeline for d2gw3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gw3b2