Lineage for d2gw3a_ (2gw3 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1899479Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1899480Protein automated matches [190526] (20 species)
    not a true protein
  7. 1899739Species Trachyphyllia geoffroyi [TaxId:196280] [188530] (1 PDB entry)
  8. 1899740Domain d2gw3a_: 2gw3 A: [164864]
    automated match to d1mova_
    complexed with ni

Details for d2gw3a_

PDB Entry: 2gw3 (more details), 1.4 Å

PDB Description: Crystal structure of stony coral fluorescent protein Kaede, green form
PDB Compounds: (A:) Kaede

SCOPe Domain Sequences for d2gw3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gw3a_ d.22.1.0 (A:) automated matches {Trachyphyllia geoffroyi [TaxId: 196280]}
pmslikpemkikllmegnvnghqfviegdgkghpfegkqsmdlvvkegaplpfaydiltt
afhygnrvfakypdhipdyfkqsfpkgfswerslmfedggvciatnditlkgdtffnkvr
fdgvnfppngpvmqkktlkweastekmylrdgvltgditmalllkgdvhyrcdfrttyks
rqegvklpgyhfvdhcisilrhdkdynevklyehavahsgl

SCOPe Domain Coordinates for d2gw3a_:

Click to download the PDB-style file with coordinates for d2gw3a_.
(The format of our PDB-style files is described here.)

Timeline for d2gw3a_: