Lineage for d2gvma_ (2gvm A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1814438Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily)
    core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection
  4. 1814439Superfamily b.138.1: Hydrophobin II, HfbII [101751] (2 families) (S)
    automatically mapped to Pfam PF06766
  5. 1814440Family b.138.1.1: Hydrophobin II, HfbII [101752] (2 proteins)
    a self-assembling amphiphile
  6. 1814459Protein automated matches [190650] (1 species)
    not a true protein
  7. 1814460Species Hypocrea jecorina [TaxId:51453] [187729] (2 PDB entries)
  8. 1814461Domain d2gvma_: 2gvm A: [164850]
    automated match to d1r2ma_
    complexed with lda, zn

Details for d2gvma_

PDB Entry: 2gvm (more details), 2.3 Å

PDB Description: Crystal structure of hydrophobin HFBI with detergent
PDB Compounds: (A:) Hydrophobin-1

SCOPe Domain Sequences for d2gvma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvma_ b.138.1.1 (A:) automated matches {Hypocrea jecorina [TaxId: 51453]}
nvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccvapvagq
allcqtavga

SCOPe Domain Coordinates for d2gvma_:

Click to download the PDB-style file with coordinates for d2gvma_.
(The format of our PDB-style files is described here.)

Timeline for d2gvma_: