Lineage for d1bh8a_ (1bh8 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1726284Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 1726328Protein TAF(II)18 [47139] (1 species)
  7. 1726329Species Human (Homo sapiens) [TaxId:9606] [47140] (2 PDB entries)
  8. 1726331Domain d1bh8a_: 1bh8 A: [16484]
    Other proteins in same PDB: d1bh8b_

Details for d1bh8a_

PDB Entry: 1bh8 (more details), 3 Å

PDB Description: htafii18/htafii28 heterodimer crystal structure
PDB Compounds: (A:) tafii18

SCOPe Domain Sequences for d1bh8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bh8a_ a.22.1.3 (A:) TAF(II)18 {Human (Homo sapiens) [TaxId: 9606]}
lfskelrcmmygfgddqnpytesvdiledlviefitemthkamsi

SCOPe Domain Coordinates for d1bh8a_:

Click to download the PDB-style file with coordinates for d1bh8a_.
(The format of our PDB-style files is described here.)

Timeline for d1bh8a_:

1726331
d1bh8a_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1bh8b_