| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.3: TBP-associated factors, TAFs [47134] (13 proteins) |
| Protein TAF(II)18 [47139] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47140] (2 PDB entries) |
| Domain d1bh8a_: 1bh8 A: [16484] Other proteins in same PDB: d1bh8b_ |
PDB Entry: 1bh8 (more details), 3 Å
SCOP Domain Sequences for d1bh8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bh8a_ a.22.1.3 (A:) TAF(II)18 {Human (Homo sapiens) [TaxId: 9606]}
lfskelrcmmygfgddqnpytesvdiledlviefitemthkamsi
Timeline for d1bh8a_: