SCOPe 2.01: Domain d2gtba_: 2gtb A:

Lineage for d2gtba_ (2gtb A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (5 species)
   contains an extra alpha-helical domain

7. Species SARS coronavirus [TaxId:227859] [89349] (55 PDB entries)

8. Domain d2gtba_: 2gtb A: [164836]
   automated match to d1uj1b_
   complexed with acy, azp

Details for d2gtba_

PDB Entry: 2gtb, 2 Å

PDB Description: Crystal structure of SARS coronavirus main peptidase (with an additional Ala at the N-terminus of each protomer) inhibited by an aza-peptide epoxide in the space group P43212

PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d2gtba_:

Sequence; same for both SEQRES and ATOM records:

>d2gtba_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
gfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirk
snhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngs
psgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkf
ygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyep
ltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc

Timeline for d2gtba_:

• d2gtba_ is new in SCOPe 2.01-stable
  
• d2gtba_ appears in SCOPe 2.02
  
• d2gtba_ appears in the current release, SCOPe 2.08