SCOPe 2.05: Domain d2gt4c_: 2gt4 C:

Lineage for d2gt4c_ (2gt4 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.5: GDP-mannose mannosyl hydrolase NudD [111132] (2 proteins)

6. Protein GDP-mannose mannosyl hydrolase NudD [111133] (1 species)

7. Species Escherichia coli [TaxId:562] [111134] (3 PDB entries)
   Uniprot P32056

8. Domain d2gt4c_: 2gt4 C: [164832]
   automated match to d1ryaa_
   complexed with bma, gdd, mg; mutant

Details for d2gt4c_

PDB Entry: 2gt4, 2.3 Å

PDB Description: crystal structure of the y103f mutant of the gdp-mannose mannosyl hydrolase in complex with gdp-mannose and mg+2

PDB Compounds: (C:) GDP-mannose mannosyl hydrolase

SCOPe Domain Sequences for d2gt4c_:

Sequence; same for both SEQRES and ATOM records:

>d2gt4c_ d.113.1.5 (C:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}
mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthfvvlgfrfrvseeelllp
deqhddyrwltsdallasdnvhansrayflaekrtgvpgl

Timeline for d2gt4c_:

• d2gt4c_ first appeared in SCOPe 2.01
  
• d2gt4c_ appears in SCOPe 2.04
  
• d2gt4c_ appears in SCOPe 2.06
  
• d2gt4c_ appears in the current release, SCOPe 2.08