Lineage for d2gt4a_ (2gt4 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971742Family d.113.1.5: GDP-mannose mannosyl hydrolase NudD [111132] (2 proteins)
  6. 2971743Protein GDP-mannose mannosyl hydrolase NudD [111133] (1 species)
  7. 2971744Species Escherichia coli [TaxId:562] [111134] (3 PDB entries)
    Uniprot P32056
  8. 2971747Domain d2gt4a_: 2gt4 A: [164830]
    automated match to d1ryaa_
    complexed with bma, gdd, mg; mutant

Details for d2gt4a_

PDB Entry: 2gt4 (more details), 2.3 Å

PDB Description: crystal structure of the y103f mutant of the gdp-mannose mannosyl hydrolase in complex with gdp-mannose and mg+2
PDB Compounds: (A:) GDP-mannose mannosyl hydrolase

SCOPe Domain Sequences for d2gt4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gt4a_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}
mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthfvvlgfrfrvseeelllp
deqhddyrwltsdallasdnvhansrayflaekrtgvpgl

SCOPe Domain Coordinates for d2gt4a_:

Click to download the PDB-style file with coordinates for d2gt4a_.
(The format of our PDB-style files is described here.)

Timeline for d2gt4a_: