![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.27: Soluble secreted chemokine inhibitor, VCCI [49888] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
![]() | Superfamily b.27.1: Soluble secreted chemokine inhibitor, VCCI [49889] (1 family) ![]() automatically mapped to Pfam PF02250 |
![]() | Family b.27.1.1: Soluble secreted chemokine inhibitor, VCCI [49890] (2 proteins) |
![]() | Protein automated matches [190665] (2 species) not a true protein |
![]() | Species Ectromelia virus [TaxId:265874] [187767] (1 PDB entry) |
![]() | Domain d2grka1: 2grk A:8-231 [164823] Other proteins in same PDB: d2grka2, d2grkb2 automated match to d1cq3a_ |
PDB Entry: 2grk (more details), 2.6 Å
SCOPe Domain Sequences for d2grka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grka1 b.27.1.1 (A:8-231) automated matches {Ectromelia virus [TaxId: 265874]} sfasscteeennhhmgidviikvtkqdqtptndkicqsvtevteseddgvseevvkgdpt tyytvvggglrmnfgftkcpqiksisesadgntvnarlssvspmygiespaitheealam indcavsinikcseeekdsnikthpvlgsnishkkvryediigstivdikcvkdlefsvr igdmckeaselevkdgfkyidgsvsegatddtslidstklkacv
Timeline for d2grka1: