SCOPe 2.07: Domain d1tafb_: 1taf B:

Lineage for d1tafb_ (1taf B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)

6. Protein TAF(II)62 [47137] (1 species)
   TAFii42 and TAFii62 form heterotetramer similar to (H3-H4)2

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47138] (1 PDB entry)

8. Domain d1tafb_: 1taf B: [16482]
   Other proteins in same PDB: d1tafa_
   complexed with zn

Details for d1tafb_

PDB Entry: 1taf, 2 Å

PDB Description: drosophila tbp associated factors dtafii42/dtafii62 heterotetramer

PDB Compounds: (B:) tfiid tbp associated factor 62

SCOPe Domain Sequences for d1tafb_:

Sequence; same for both SEQRES and ATOM records:

>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mlygssisaesmkviaesigvgslsddaakelaedvsiklkrivqdaakfmnhakrqkls
vrdidmslkv

Timeline for d1tafb_:

• d1tafb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tafb_ appears in SCOPe 2.06
  
• d1tafb_ appears in the current release, SCOPe 2.08