Lineage for d1tafb_ (1taf B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1483188Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 1483243Protein TAF(II)62 [47137] (1 species)
    TAFii42 and TAFii62 form heterotetramer similar to (H3-H4)2
  7. 1483244Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47138] (1 PDB entry)
  8. 1483245Domain d1tafb_: 1taf B: [16482]
    Other proteins in same PDB: d1tafa_
    complexed with zn

Details for d1tafb_

PDB Entry: 1taf (more details), 2 Å

PDB Description: drosophila tbp associated factors dtafii42/dtafii62 heterotetramer
PDB Compounds: (B:) tfiid tbp associated factor 62

SCOPe Domain Sequences for d1tafb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mlygssisaesmkviaesigvgslsddaakelaedvsiklkrivqdaakfmnhakrqkls
vrdidmslkv

SCOPe Domain Coordinates for d1tafb_:

Click to download the PDB-style file with coordinates for d1tafb_.
(The format of our PDB-style files is described here.)

Timeline for d1tafb_: