Lineage for d2grjd_ (2grj D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987026Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 987195Protein Dephospho-CoA kinase [75187] (4 species)
  7. 987214Species Thermotoga maritima [TaxId:2336] [187766] (1 PDB entry)
  8. 987218Domain d2grjd_: 2grj D: [164818]
    automated match to d1jjva_
    complexed with adp, cl, cod

Details for d2grjd_

PDB Entry: 2grj (more details), 2.6 Å

PDB Description: crystal structure of dephospho-coa kinase (ec 2.7.1.24) (dephosphocoenzyme a kinase) (tm1387) from thermotoga maritima at 2.60 a resolution
PDB Compounds: (D:) dephospho-coa kinase

SCOPe Domain Sequences for d2grjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grjd_ c.37.1.1 (D:) Dephospho-CoA kinase {Thermotoga maritima [TaxId: 2336]}
hhhmvigvtgkigtgkstvceilknkygahvvnvdrighevleevkeklvelfggsvled
gkvnrkklagivfesrenlkklellvhplmkkrvqeiinktsglivieaallkrmgldql
cdhvitvvasretilkrnreadrrlkfqedivpqgivvannstledlekkveevmklvw

SCOPe Domain Coordinates for d2grjd_:

Click to download the PDB-style file with coordinates for d2grjd_.
(The format of our PDB-style files is described here.)

Timeline for d2grjd_: