Lineage for d2grjb1 (2grj B:1-176)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123551Protein Dephospho-CoA kinase [75187] (4 species)
  7. 2123570Species Thermotoga maritima [TaxId:2336] [187766] (1 PDB entry)
  8. 2123572Domain d2grjb1: 2grj B:1-176 [164816]
    Other proteins in same PDB: d2grja2, d2grjb2, d2grjc2, d2grjd2, d2grje2, d2grjf2, d2grjg2, d2grjh2
    automated match to d1jjva_
    complexed with adp, cl, cod

Details for d2grjb1

PDB Entry: 2grj (more details), 2.6 Å

PDB Description: crystal structure of dephospho-coa kinase (ec 2.7.1.24) (dephosphocoenzyme a kinase) (tm1387) from thermotoga maritima at 2.60 a resolution
PDB Compounds: (B:) dephospho-coa kinase

SCOPe Domain Sequences for d2grjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grjb1 c.37.1.1 (B:1-176) Dephospho-CoA kinase {Thermotoga maritima [TaxId: 2336]}
mvigvtgkigtgkstvceilknkygahvvnvdrighevleevkeklvelfggsvledgkv
nrkklagivfesrenlkklellvhplmkkrvqeiinktsglivieaallkrmgldqlcdh
vitvvasretilkrnreadrrlkfqedivpqgivvannstledlekkveevmklvw

SCOPe Domain Coordinates for d2grjb1:

Click to download the PDB-style file with coordinates for d2grjb1.
(The format of our PDB-style files is described here.)

Timeline for d2grjb1: