Lineage for d2grha_ (2grh A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686141Protein Hemoglobin I [46464] (2 species)
  7. 2686142Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries)
  8. 2686189Domain d2grha_: 2grh A: [164813]
    automated match to d1nxfa_
    complexed with cmo, hem; mutant

Details for d2grha_

PDB Entry: 2grh (more details), 1.5 Å

PDB Description: m37v mutant of scapharca dimeric hemoglobin, with co bound
PDB Compounds: (A:) Globin-1

SCOPe Domain Sequences for d2grha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalvttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d2grha_:

Click to download the PDB-style file with coordinates for d2grha_.
(The format of our PDB-style files is described here.)

Timeline for d2grha_: