SCOPe 2.04: Domain d2grfa_: 2grf A:

Lineage for d2grfa_ (2grf A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (38 species)
   not a true protein

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (31 PDB entries)

8. Domain d2grfa_: 2grf A: [164811]
   automated match to d1nxfa_
   complexed with hem; mutant

Details for d2grfa_

PDB Entry: 2grf, 2.1 Å

PDB Description: crystal structure of scapharca inaequivalvis hbi, m37v mutant in the absence of ligand

PDB Compounds: (A:) Globin-1

SCOPe Domain Sequences for d2grfa_:

Sequence; same for both SEQRES and ATOM records:

>d2grfa_ a.1.1.2 (A:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalvttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d2grfa_:

• d2grfa_ first appeared in SCOPe 2.01
  
• d2grfa_ appears in SCOPe 2.03
  
• d2grfa_ appears in SCOPe 2.05
  
• d2grfa_ appears in the current release, SCOPe 2.08