Lineage for d1tafa_ (1taf A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1726284Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 1726336Protein TAF(II)42 [47135] (1 species)
    TAFii42 and TAFii62 form heterotetramer similar to (H3-H4)2
  7. 1726337Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47136] (1 PDB entry)
  8. 1726338Domain d1tafa_: 1taf A: [16481]
    Other proteins in same PDB: d1tafb_
    complexed with zn

Details for d1tafa_

PDB Entry: 1taf (more details), 2 Å

PDB Description: drosophila tbp associated factors dtafii42/dtafii62 heterotetramer
PDB Compounds: (A:) tfiid tbp associated factor 42

SCOPe Domain Sequences for d1tafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pkdaqvimsilkelnvqeyeprvvnqlleftfryvtsilddakvyanharkktidlddvr
latevtld

SCOPe Domain Coordinates for d1tafa_:

Click to download the PDB-style file with coordinates for d1tafa_.
(The format of our PDB-style files is described here.)

Timeline for d1tafa_: