SCOPe 2.06: Domain d2gqgb1: 2gqg B:229-499

Lineage for d2gqgb1 (2gqg B:229-499)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries)

8. Domain d2gqgb1: 2gqg B:229-499 [164801]
   Other proteins in same PDB: d2gqga2, d2gqgb2
   automated match to d1opja_
   complexed with 1n1, gol

Details for d2gqgb1

PDB Entry: 2gqg, 2.4 Å

PDB Description: x-ray crystal structure of dasatinib (bms-354825) bound to activated abl kinase domain

PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d2gqgb1:

Sequence; same for both SEQRES and ATOM records:

>d2gqgb1 d.144.1.7 (B:229-499) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap
eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv
yelmracwqwnpsdrpsfaeihqafetmfqe

Timeline for d2gqgb1:

• d2gqgb1 first appeared in SCOPe 2.01, called d2gqgb_
  
• d2gqgb1 was called d2gqgb_ in SCOPe 2.05
  
• d2gqgb1 appears in SCOPe 2.07
  
• d2gqgb1 appears in the current release, SCOPe 2.08