Lineage for d2gqaa_ (2gqa A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1816697Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1817199Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 1817200Protein automated matches [190048] (17 species)
    not a true protein
  7. 1817288Species Shewanella oneidensis [TaxId:211586] [187764] (6 PDB entries)
  8. 1817293Domain d2gqaa_: 2gqa A: [164799]
    automated match to d1gwja_
    complexed with fmn, so4

Details for d2gqaa_

PDB Entry: 2gqa (more details), 1.7 Å

PDB Description: structure of nadh-reduced sye1, an oye homologue from s. oneidensis
PDB Compounds: (A:) oxidoreductase, FMN-binding

SCOPe Domain Sequences for d2gqaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gqaa_ c.1.4.0 (A:) automated matches {Shewanella oneidensis [TaxId: 211586]}
tqslfqpitlgaltlknrivmppmtrsrasqpgdvanhmmaiyyaqrasaglivsegtqi
sptakgyawtpgiytpeqiagwrivteavhakgcaifaqlwhvgrvthpdnidgqqpiss
stlkaenvkvfvdngsdepgfvdvavpramtkadiaqviadyrqaalnameagfdgielh
aangylinqfidseannrsdeyggslenrlrfldevvaalvdaigaervgvrlaplttln
gtvdadpiltytaaaallnkhrivylhiaevdwddapdtpvsfkralreayqgvliyagr
ynaekaeqaindgladmigfgrpfianpdlperlrhgyplaehvpatlfgggekgltdyp
tyqa

SCOPe Domain Coordinates for d2gqaa_:

Click to download the PDB-style file with coordinates for d2gqaa_.
(The format of our PDB-style files is described here.)

Timeline for d2gqaa_: