Lineage for d2gq9a_ (2gq9 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080511Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2080512Protein automated matches [190048] (21 species)
    not a true protein
  7. 2080599Species Shewanella oneidensis [TaxId:211586] [187764] (9 PDB entries)
  8. 2080605Domain d2gq9a_: 2gq9 A: [164798]
    automated match to d1gwja_
    complexed with fmn, hba, so4

Details for d2gq9a_

PDB Entry: 2gq9 (more details), 1.7 Å

PDB Description: structure of sye1, an oye homologue from s. oneidensis, in complex with p-hydroxybenzaldehyde
PDB Compounds: (A:) oxidoreductase, FMN-binding

SCOPe Domain Sequences for d2gq9a_:

Sequence, based on SEQRES records: (download)

>d2gq9a_ c.1.4.0 (A:) automated matches {Shewanella oneidensis [TaxId: 211586]}
mtqslfqpitlgaltlknrivmppmtrsrasqpgdvanhmmaiyyaqrasaglivsegtq
isptakgyawtpgiytpeqiagwrivteavhakgcaifaqlwhvgrvthpdnidgqqpis
sstlkaenvkvfvdngsdepgfvdvavpramtkadiaqviadyrqaalnameagfdgiel
haangylinqfidseannrsdeyggslenrlrfldevvaalvdaigaervgvrlaplttl
ngtvdadpiltytaaaallnkhrivylhiaevdwddapdtpvsfkralreayqgvliyag
rynaekaeqaindgladmigfgrpfianpdlperlrhgyplaehvpatlfgggekgltdy
ptyqa

Sequence, based on observed residues (ATOM records): (download)

>d2gq9a_ c.1.4.0 (A:) automated matches {Shewanella oneidensis [TaxId: 211586]}
mtqslfqpitlgaltlknrivmppmtrsrasqpgdvanhmmaiyyaqrasaglivsegtq
isptakgyawtpgiytpeqiagwrivteavhakgcaifaqlwhvgrvthpdnidgqqpis
sstlkaenvkvfvdnepgfvdvavpramtkadiaqviadyrqaalnameagfdgielhaa
ngylinqfidseannrsdeyggslenrlrfldevvaalvdaigaervgvrlaplttlngt
vdadpiltytaaaallnkhrivylhiaevdwddapdtpvsfkralreayqgvliyagryn
aekaeqaindgladmigfgrpfianpdlperlrhgyplaehvpatlfgggekgltdypty
qa

SCOPe Domain Coordinates for d2gq9a_:

Click to download the PDB-style file with coordinates for d2gq9a_.
(The format of our PDB-style files is described here.)

Timeline for d2gq9a_: