SCOPe 2.07: Domain d2gpzc_: 2gpz C:

Lineage for d2gpzc_ (2gpz C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.0: automated matches [191441] (1 protein)
   not a true family

6. Protein automated matches [190651] (8 species)
   not a true protein

7. Species Salmonella enterica [TaxId:98360] [187762] (1 PDB entry)

8. Domain d2gpzc_: 2gpz C: [164796]
   automated match to d1sn0a_
   complexed with so4

Details for d2gpzc_

PDB Entry: 2gpz, 2.5 Å

PDB Description: Transthyretin-like protein from Salmonella dublin

PDB Compounds: (C:) transthyretin-like protein

SCOPe Domain Sequences for d2gpzc_:

Sequence, based on SEQRES records:

>d2gpzc_ b.3.4.0 (C:) automated matches {Salmonella enterica [TaxId: 98360]}
milsvhildqqtgkpapgvevvleqkkdngwtqlntghtdqdgrikalwpekaaapgdyr
vifktgqyfeskkldtffpeipvefhisktnehyhvplllsqygystyrgs

Sequence, based on observed residues (ATOM records):

>d2gpzc_ b.3.4.0 (C:) automated matches {Salmonella enterica [TaxId: 98360]}
milsvhildqqtgkpapgvevvleqkkdgwtqlntghtdqdgrikalwpekaaapgdyrv
ifktgqyfeskkldtffpeipvefhisktnehyhvplllsqygystyrgs

Timeline for d2gpzc_:

• d2gpzc_ first appeared in SCOPe 2.01
  
• d2gpzc_ appears in SCOPe 2.06
  
• d2gpzc_ appears in the current release, SCOPe 2.08