Lineage for d2gpza_ (2gpz A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1772955Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1773528Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 1773529Protein automated matches [190651] (7 species)
    not a true protein
  7. 1773559Species Salmonella enterica [TaxId:98360] [187762] (1 PDB entry)
  8. 1773560Domain d2gpza_: 2gpz A: [164795]
    automated match to d1sn0a_
    complexed with so4

Details for d2gpza_

PDB Entry: 2gpz (more details), 2.5 Å

PDB Description: Transthyretin-like protein from Salmonella dublin
PDB Compounds: (A:) transthyretin-like protein

SCOPe Domain Sequences for d2gpza_:

Sequence, based on SEQRES records: (download)

>d2gpza_ b.3.4.0 (A:) automated matches {Salmonella enterica [TaxId: 98360]}
milsvhildqqtgkpapgvevvleqkkdngwtqlntghtdqdgrikalwpekaaapgdyr
vifktgqyfeskkldtffpeipvefhisktnehyhvplllsqygystyrgs

Sequence, based on observed residues (ATOM records): (download)

>d2gpza_ b.3.4.0 (A:) automated matches {Salmonella enterica [TaxId: 98360]}
milsvhildqqtgkpapgvevvleqkkdgwtqlntghtdqdgrikalwpekaaapgdyrv
ifktgqyfeskkldtffpeipvefhisktnehyhvplllsqygystyrgs

SCOPe Domain Coordinates for d2gpza_:

Click to download the PDB-style file with coordinates for d2gpza_.
(The format of our PDB-style files is described here.)

Timeline for d2gpza_: