Class b: All beta proteins [48724] (176 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) |
Family b.3.4.0: automated matches [191441] (1 protein) not a true family |
Protein automated matches [190651] (7 species) not a true protein |
Species Salmonella enterica [TaxId:98360] [187762] (1 PDB entry) |
Domain d2gpza_: 2gpz A: [164795] automated match to d1sn0a_ complexed with so4 |
PDB Entry: 2gpz (more details), 2.5 Å
SCOPe Domain Sequences for d2gpza_:
Sequence, based on SEQRES records: (download)
>d2gpza_ b.3.4.0 (A:) automated matches {Salmonella enterica [TaxId: 98360]} milsvhildqqtgkpapgvevvleqkkdngwtqlntghtdqdgrikalwpekaaapgdyr vifktgqyfeskkldtffpeipvefhisktnehyhvplllsqygystyrgs
>d2gpza_ b.3.4.0 (A:) automated matches {Salmonella enterica [TaxId: 98360]} milsvhildqqtgkpapgvevvleqkkdgwtqlntghtdqdgrikalwpekaaapgdyrv ifktgqyfeskkldtffpeipvefhisktnehyhvplllsqygystyrgs
Timeline for d2gpza_: