Lineage for d2gpha_ (2gph A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219987Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2220035Species Norway rat (Rattus norvegicus) [TaxId:10116] [56136] (36 PDB entries)
  8. 2220051Domain d2gpha_: 2gph A: [164794]
    automated match to d1erka_

Details for d2gpha_

PDB Entry: 2gph (more details), 1.9 Å

PDB Description: docking motif interactions in the map kinase erk2
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d2gpha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gpha_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
emvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlre
ikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllkcqhlsndhicyfly
qilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvatr
wyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqed
lnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahp
yleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqp

SCOPe Domain Coordinates for d2gpha_:

Click to download the PDB-style file with coordinates for d2gpha_.
(The format of our PDB-style files is described here.)

Timeline for d2gpha_: