Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Shewanella oneidensis [TaxId:70863] [187761] (1 PDB entry) |
Domain d2goua_: 2gou A: [164788] automated match to d1gwja_ complexed with bog, fmn, pe4, so4, trs |
PDB Entry: 2gou (more details), 1.4 Å
SCOPe Domain Sequences for d2goua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2goua_ c.1.4.0 (A:) automated matches {Shewanella oneidensis [TaxId: 70863]} mtqslfqpitlgaltlknrivmppmtrsrasqpgdvanhmmaiyyaqrasaglivsegtq isptakgyawtpgiytpeqiagwrivteavhakgcaifaqlwhvgrvthpdnidgqqpis sstlkaenvkvfvdngsdepgfvdvavpramtkadiaqviadyrqaalnameagfdgiel haangylinqfidseannrsdeyggslenrlrfldevvaalvdaigaervgvrlaplttl ngtvdadpiltytaaaallnkhrivylhiaevdwddapdtpvsfkralreayqgvliyag rynaekaeqaindgladmigfgrpfianpdlperlrhgyplaehvpatlfgggekgltdy ptyqa
Timeline for d2goua_: