Lineage for d2goua_ (2gou A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2828459Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2828460Protein automated matches [190048] (31 species)
    not a true protein
  7. 2828693Species Shewanella oneidensis [TaxId:70863] [187761] (1 PDB entry)
  8. 2828694Domain d2goua_: 2gou A: [164788]
    automated match to d1gwja_
    complexed with bog, fmn, pe4, so4, trs

Details for d2goua_

PDB Entry: 2gou (more details), 1.4 Å

PDB Description: structure of wild type, oxidized sye1, an oye homologue from s. oneidensis
PDB Compounds: (A:) oxidoreductase, FMN-binding

SCOPe Domain Sequences for d2goua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2goua_ c.1.4.0 (A:) automated matches {Shewanella oneidensis [TaxId: 70863]}
mtqslfqpitlgaltlknrivmppmtrsrasqpgdvanhmmaiyyaqrasaglivsegtq
isptakgyawtpgiytpeqiagwrivteavhakgcaifaqlwhvgrvthpdnidgqqpis
sstlkaenvkvfvdngsdepgfvdvavpramtkadiaqviadyrqaalnameagfdgiel
haangylinqfidseannrsdeyggslenrlrfldevvaalvdaigaervgvrlaplttl
ngtvdadpiltytaaaallnkhrivylhiaevdwddapdtpvsfkralreayqgvliyag
rynaekaeqaindgladmigfgrpfianpdlperlrhgyplaehvpatlfgggekgltdy
ptyqa

SCOPe Domain Coordinates for d2goua_:

Click to download the PDB-style file with coordinates for d2goua_.
(The format of our PDB-style files is described here.)

Timeline for d2goua_: