SCOPe 2.06: Domain d2gond_: 2gon D:

Lineage for d2gond_ (2gon D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)

8. Domain d2gond_: 2gon D: [164787]
   automated match to d1afva_
   complexed with flc

Details for d2gond_

PDB Entry: 2gon, 1.9 Å

PDB Description: xray structure of gag133-278

PDB Compounds: (D:) Capsid protein p24 (CA)

SCOPe Domain Sequences for d2gond_:

Sequence, based on SEQRES records:

>d2gond_ a.73.1.1 (D:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
qaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlket
ineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmthnppipvgeiykr
wiilglnkivrmys

Sequence, based on observed residues (ATOM records):

>d2gond_ a.73.1.1 (D:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
qaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlket
ineeaaewdrlhpvhpgqmreprgsdiagttstlqeqigwmthnppipvgeiykrwiilg
lnkivrmys

Timeline for d2gond_:

• d2gond_ first appeared in SCOPe 2.01
  
• d2gond_ appears in SCOPe 2.05
  
• d2gond_ appears in SCOPe 2.07
  
• d2gond_ appears in the current release, SCOPe 2.08