Lineage for d2gond_ (2gon D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717857Protein HIV-1 capsid protein [47945] (1 species)
  7. 2717858Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2717889Domain d2gond_: 2gon D: [164787]
    automated match to d1afva_
    complexed with flc

Details for d2gond_

PDB Entry: 2gon (more details), 1.9 Å

PDB Description: xray structure of gag133-278
PDB Compounds: (D:) Capsid protein p24 (CA)

SCOPe Domain Sequences for d2gond_:

Sequence, based on SEQRES records: (download)

>d2gond_ a.73.1.1 (D:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
qaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlket
ineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmthnppipvgeiykr
wiilglnkivrmys

Sequence, based on observed residues (ATOM records): (download)

>d2gond_ a.73.1.1 (D:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
qaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlket
ineeaaewdrlhpvhpgqmreprgsdiagttstlqeqigwmthnppipvgeiykrwiilg
lnkivrmys

SCOPe Domain Coordinates for d2gond_:

Click to download the PDB-style file with coordinates for d2gond_.
(The format of our PDB-style files is described here.)

Timeline for d2gond_: