Lineage for d2gona_ (2gon A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000631Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2000632Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2000633Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 protein domains)
  6. 2000672Protein HIV-1 capsid protein [47945] (1 species)
  7. 2000673Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)
  8. 2000709Domain d2gona_: 2gon A: [164784]
    automated match to d1afva_
    complexed with flc

Details for d2gona_

PDB Entry: 2gon (more details), 1.9 Å

PDB Description: Xray Structure of Gag133-278
PDB Compounds: (A:) Capsid protein p24 (CA)

SCOPe Domain Sequences for d2gona_:

Sequence, based on SEQRES records: (download)

>d2gona_ a.73.1.1 (A:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
hqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlke
tineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmthnppipvgeiyk
rwiilglnkivrmys

Sequence, based on observed residues (ATOM records): (download)

>d2gona_ a.73.1.1 (A:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
hqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlke
tineeaaewdrlhpvhmreprgsdiagttstlqeqigwmthnppipvgeiykrwiilgln
kivrmys

SCOPe Domain Coordinates for d2gona_:

Click to download the PDB-style file with coordinates for d2gona_.
(The format of our PDB-style files is described here.)

Timeline for d2gona_: