Lineage for d2gnwb_ (2gnw B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688388Protein Non-symbiotic plant hemoglobin [46484] (1 species)
  7. 2688389Species Rice (Oryza sativa) [TaxId:4530] [46485] (3 PDB entries)
  8. 2688391Domain d2gnwb_: 2gnw B: [164779]
    automated match to d1d8ua_
    complexed with hem; mutant

Details for d2gnwb_

PDB Entry: 2gnw (more details), 2.4 Å

PDB Description: crystal structure of non-symbiotic plant hemoglobin from rice, b10 mutant f40w
PDB Compounds: (B:) Non-symbiotic hemoglobin 1

SCOPe Domain Sequences for d2gnwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gnwb_ a.1.1.2 (B:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa) [TaxId: 4530]}
alvednnavavsfseeqealvlkswailkkdsanialrfwlkifevapsasqmfsflrns
dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae

SCOPe Domain Coordinates for d2gnwb_:

Click to download the PDB-style file with coordinates for d2gnwb_.
(The format of our PDB-style files is described here.)

Timeline for d2gnwb_: