Lineage for d2gnvb_ (2gnv B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903542Protein Non-symbiotic plant hemoglobin [46484] (1 species)
  7. 903543Species Rice (Oryza sativa) [TaxId:4530] [46485] (3 PDB entries)
  8. 903545Domain d2gnvb_: 2gnv B: [164777]
    automated match to d1d8ua_
    complexed with dio, hem; mutant

Details for d2gnvb_

PDB Entry: 2gnv (more details), 2.3 Å

PDB Description: crystal structure of non-symbiotic plant hemoglobin from rice, b10 mutant f40l
PDB Compounds: (B:) Non-symbiotic hemoglobin 1

SCOPe Domain Sequences for d2gnvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gnvb_ a.1.1.2 (B:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa) [TaxId: 4530]}
vsfseeqealvlkswailkkdsanialrfllkifevapsasqmfsflrnsdvpleknpkl
kthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfevvkfalldtik
eevpadmwspamksawseaydhlvaaikqemkpae

SCOPe Domain Coordinates for d2gnvb_:

Click to download the PDB-style file with coordinates for d2gnvb_.
(The format of our PDB-style files is described here.)

Timeline for d2gnvb_: