Lineage for d2gn1b_ (2gn1 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1006039Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1006040Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1006300Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 1006301Protein automated matches [190215] (6 species)
    not a true protein
  7. 1006332Species Salmonella typhimurium [TaxId:90371] [187759] (3 PDB entries)
  8. 1006338Domain d2gn1b_: 2gn1 B: [164768]
    automated match to d1v71a1
    complexed with na

Details for d2gn1b_

PDB Entry: 2gn1 (more details), 2.2 Å

PDB Description: Crystal structure of dimeric biodegradative threonine deaminase (TdcB) from Salmonella typhimurium at 2.2A resolution (Triclinic form with one dimer of TdcB in the asymmetric unit)
PDB Compounds: (B:) Threonine dehydratase catabolic

SCOPe Domain Sequences for d2gn1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gn1b_ c.79.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ydlpvaiedileakkrlagkiyktgmprsnyfserckgeiflkfenmqrtgsfkirgafn
klsslteaekrkgvvacsagnhaqgvslscamlgidgkvvmpkgapkskvaatcdysaev
vlhgdnfndtiakvseivetegrifippyddpkviagqgtigleimedlydvdnvivpig
gggliagiaiaiksinptikvigvqaenvhgmaasyytgeitthrttgtladgcdvsrpg
nltyeivrelvddivlvsedeirnsmialiqrnkvitegagalacaallsgkldshiqnr
ktvsiisggnidlsrvsqitg

SCOPe Domain Coordinates for d2gn1b_:

Click to download the PDB-style file with coordinates for d2gn1b_.
(The format of our PDB-style files is described here.)

Timeline for d2gn1b_: