Lineage for d2gn0a_ (2gn0 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1874686Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1874687Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1874993Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 1874994Protein automated matches [190215] (23 species)
    not a true protein
  7. 1875075Species Salmonella typhimurium [TaxId:90371] [187759] (13 PDB entries)
  8. 1875080Domain d2gn0a_: 2gn0 A: [164763]
    automated match to d1v71a1
    complexed with na

Details for d2gn0a_

PDB Entry: 2gn0 (more details), 1.7 Å

PDB Description: Crystal structure of dimeric biodegradative threonine deaminase (TdcB) from Salmonella typhimurium at 1.7 A resolution (Triclinic form with one complete subunit built in alternate conformation)
PDB Compounds: (A:) Threonine dehydratase catabolic

SCOPe Domain Sequences for d2gn0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gn0a_ c.79.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mashitydlpvaiedileakkrlagkiyktgmprsnyfserckgeiflkfenmqrtgsfk
irgafnklsslteaekrkgvvacsagnhaqgvslscamlgidgkvvmpkgapkskvaatc
dysaevvlhgdnfndtiakvseivetegrifippyddpkviagqgtigleimedlydvdn
vivpiggggliagiaiaiksinptikvigvqaenvhgmaasyytgeitthrttgtladgc
dvsrpgnltyeivrelvddivlvsedeirnsmialiqrnkvitegagalacaallsgkld
shiqnrktvsiisggnidlsrvsqitg

SCOPe Domain Coordinates for d2gn0a_:

Click to download the PDB-style file with coordinates for d2gn0a_.
(The format of our PDB-style files is described here.)

Timeline for d2gn0a_: